Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214645
StrainM_smegmatis_MKD8
Protein IDZP_20976201.1
Description tetR-family protein transcriptional regulator [Mycobacterium smegmat
Sequence MAKATSSVLPPAERILAAAADLLRAGGIDAVSTRAVATEAGVQPPTIYRQ
FGDKDGLLDAVTRHVLESYIDRKRLLTNPDADPALILRELWDLHVEFGMQ
QPHCYLLTYGQGRRTSAADETVSILGEVIGRLGAAGRLTMSVRRATDYFR
ASGTGFVMSQLSLASEERDAELSGIIFENTLAAVSTDGRRGRGRKANDVR
ARAVALREALPESRTPALSAAEQGLLAEWLDRLADQA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo