Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214656
StrainM_smegmatis_MKD8
Protein IDZP_20976212.1
Description putative glutamine ABC transporter glutamine-binding/permease protei
Sequence MLAVAALVGLIPMVAPATASAEGETYVVATDITFAPFEFQDASGKFVGID
IDLINEIAADQNFTVTIKPLGFDAALQAVQANQADGVIAGMSITDERKKV
FDFSDPYFESGVQMAVLASDDDIKSYEDLRGKRVAVKNGTEGAEFAESIK
DKYGFTTVYFADSASMFDEVRTGNSQAVFEDYPVLQYGIAQGNGFKTVTP
KEKGANYGFAVNKGQNAELLQKFNAGLAQLKESGRYDEIISTYLGEEAVD
NDNSFLGLLKSTFPILMIGLRMTLILTVVSIAIALVLGVIFGLLRVSRSV
VLRAIGTTYVDIFRGTPLLVQAFFIYFGIPSALGFQMSALTAGIITLSLN
AGAYMTEIVRGGIQSVDKGQMEAARSLGIGYLPTMRKVILPQAIRTMIPS
YINQFVITLKDTSILSVIGIAELTQTGRIIIARNFQSFTMWLIIGIIYFV
VIMALTKLSDRVEKRLVK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo