Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214658
StrainM_smegmatis_MKD8
Protein IDZP_20976214.1
Description hypothetical protein D806_5382 [Mycobacterium smegmatis MKD8]
Sequence MTSTRTRQAFAAAGAGAAALSALLAFATPAHAESAALTIGQLEAQGFDVR
VDRVGSAPLEQCVVTGIRNPRERTRIVRFDGPRGRDRLVPVVVQRSITVS
LDCSRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo