Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214697
StrainM_smegmatis_MKD8
Protein IDZP_20976253.1
Description hypothetical protein D806_5421 [Mycobacterium smegmatis MKD8]
Sequence MTDVANVTAGDAAPEAKSEDASTPVESAATPVGEETTAPVAAPSGRRTWS
IPKSPISREQADQAGRAALAAGSAVGRFLAEVARYIARAVAQCGRAVEAV
PVALRLFVFAAVVMLLGIVGAIASNDALGLLCTVVVIPVCAATLGVLGQR
WYSGLGDQPARQSSEEIAAQPDLQRSVEYVDKKLAVALTAMGTERHQQAV
ISLFQAKTALELTLGTEQDSATFLEMPMPADDHPLRPRIRVGSKSQLRES
NSLAAS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo