Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214704
StrainM_smegmatis_MKD8
Protein IDZP_20976260.1
Description ectoine/hydroxyectoine ABC transporter- permease protein EhuC [Mycob
Sequence MLDKLIDAAPLFLQGAGVTMLYTVLGALAALVVSFVFGLMSLSGSVAARG
FSRVVVEFFRGTSLVIQLLWIFFVLPQLGLRFEPMAAATLAFGLNFGAYG
AEVVRGAIASVPSTQWEATVALGLGRFRRMRRVILPQALPEMVPPFGNLW
IQILKSSSLLYLIGITELTFEVKQLQFDVGSMAAFSIALVVYFVLAQVLV
AVTRFVEARAAAGVGRRPKAVVVEAEPVVTGR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo