Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214718
StrainM_smegmatis_MKD8
Protein IDZP_20976274.1
Description PE-PGRS family protein [Mycobacterium smegmatis MKD8]
Sequence MHNAAADATARGVDNQFSAAALDITAAGSPASGPTPPAQRVGDVPDPAAA
VNDFILLFVGNGTATHPDAGLLIGNGFSYTAETCPDGKVCNGGRSGLIGV
GGAGFNGGTGGSTLLFGNGGAGGSGVAWANSGNGGHGGHGGLFLGTGGDG
GAGAAGVAGVNGGDGGAGGRRGNSGAFALFAQAGNGGAGGAGANGGNGAT
TTESGASGAAGVAGGRGGNGGNGGSVGLFAIFATAGAGGAGGAGGNGGAG
GNGGNGSSNPGNGGAGGDAIITNVASTANATAGAGGNGGFASYAGAGGDG
GNATHHGLGDAIAGSGGNGGNGASRPGAGGNGGTAEHYGYGNATAGKGGT
GGDGGLSSGGGGNGGGAYIHNSESTGTATAGTGGNGGAVDYSWNNEQGGH
GGAGGNAENAGTGSALGGGGGNGGTIIRNTSGSRGGDGGTGGKAASGGTA
TAGAGGNGGNGFIGGNGGSGGDALVFDITSTDDATGGDGGNGGFGTSGAN
GVGGGGGSATNYGSGAATDGADGANGSL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo