Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214720
StrainM_smegmatis_MKD8
Protein IDZP_20976276.1
Description putative short chain dehydrogenase domain protein [Mycobacterium sme
Sequence MKGDVEHVVGGVFRGREGAAARVVHQDVDHAARHLESVRGQRAHRRRIAE
IGRERQRGTAVGGDAVDDFPGPRFIASAHDHGVTVPRQQQCGLPPDPTRR
AGDQRPSTRCRALLGV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo