Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214727
StrainM_smegmatis_MKD8
Protein IDZP_20976283.1
Description orn/DAP/Arg decarboxylase 2 [Mycobacterium smegmatis MKD8]
Sequence MELALPANALRDKAVARWVRDRSVAVEVRDRHELAIAQSAGVHPSRVTAH
AEGLSIDELVFCSVGLRVGRVVVTRADHVDVLAVTRRRQAVLLGSLRRRL
TRTVFDCATVDVVGMYGDVDHAAHHSVSYPSAVGAMLAEMSRIRRDHGVM
LTRIALGGRHLTFGAGAGELSEVSAAVDGTLDDACATLRFPRPSVVVSAS
PAV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo