Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214883
StrainM_smegmatis_MKD8
Protein IDZP_20976328.1
Description putative serine/threonine-protein kinase PknB [Mycobacterium smegmat
Sequence MWVESPGEHIAGFVVEDVAGRGGWAVVYRARDAQGRLVALKVLNESHREP
AHLERLRREFEFACRAEHPNVVAMYAAGDGWLAMEFIDGRPATSLAARTD
QLTALRQIAGALDNIHRLGIVHSDVKPMNILVDKPFSRAVLIDFGVAHSL
AEDVAARLAADATGRLTLDPARRITHQSAASRPQVQASLPYSAPELITGR
ALSAATDQYALACTAVEILTGLPPFTATTAVKMVDQQLNSPPPRISGRAA
WIPHAVDAILAKALSKDPERRHESCTEFVDELAAALG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo