Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214921
StrainM_smegmatis_MKD8
Protein IDZP_20976366.1
Description 2-hydroxy-3-oxopropionate reductase [Mycobacterium smegmatis MKD8]
Sequence MSTIAFIGLGIMGSPMAVNLVKAGHTVKGYNRSPHRTADLVAAGGTAADS
IADAVDGAEIVAVMVPDSPDVTEVLTADGGVFASAAPGTLIIDFSSIRPD
VSMDLAKQAADHDLRLIDAPVSGGEIGAKNAALSIMIGGADEDVSRAMPV
LEAVGKTIVHVGPNGAGQTVKAANQLIVAGNIALLAEAIIFLEAYGVDTT
AAVKVLGGGLAGSAVLDQKAQKMLDRSFDPGFRIELHHKDLGILTNAARE
AGVVTPIGAAVAQLMASARINGDGALDHSGLFRTIAKLSGASTEPGSSNT
KERP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo