Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214926
StrainM_smegmatis_MKD8
Protein IDZP_20976371.1
Description flagellar basal body P-ring biosynthesis protein [Mycobacterium smeg
Sequence MAEFLNPTAWHRLTAAMRPDWTRTVAARRAAAAGLVLLAAVAAVRSDPRG
DHVDVAVAARDLVPGTALTAEDVRLESRSASTLPDGAQSDVGAIVGATLA
GPMRRGEVLTDVRVIGSRLADLAVGPDARIVPLSLGDAALLDVIRAGDVV
DVLTTHDEEAKSATPRLIASDAVVVLVSQKPKGAGQDRVALVALPARSAH
EVAAASLTQAVTLTIH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo