Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214941
StrainM_smegmatis_MKD8
Protein IDZP_20976386.1
Description enoyl-CoA hydratase/isomerase [Mycobacterium smegmatis MKD8]
Sequence MDTLVRYEVDGAVARLTLDSPHNRNALSTALVEQLHEGFARAARQSGVRV
VVLGHTGGTFCAGADLSEAAGRDPADIAVDRAREMTTLLRAILELRLPVI
GAIDGHVRAGGLGLVGACDVVVAGPGSTFALTEARIGVAPSIISLTLLPK
MTPRSAGRYFLTGERFGAEEAAAVGLVTVAADDVDTAVAALAGEIAKGSP
QGLATSKALTTAAILRDFDEHAEELTQQSARLFVSDEAREGMLAFLQKRP
PNWAD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo