Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214992
StrainM_smegmatis_MKD8
Protein IDZP_20976437.1
Description transcriptional regulator- HTH_3 family protein [Mycobacterium smegm
Sequence MRRGETLPIYNRIAVLRAERRMSRAELAGLINVNPQTVGALERGDHYPSL
DLAFRICDVFGLPVEAVFSRTAFTPLSTELYRRTGQPEGSADD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo