Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215165
StrainM_smegmatis_MKD8
Protein IDZP_20976449.1
Description cheR methyltransferase- SAM binding domain protein [Mycobacterium sm
Sequence MEQADESFEALLRYMRDSRGFDFTGYKRTSLMRRVRHRMDQAGHDTFEEY
LDVLQASSDEFSALFNTILINVTAFFRDPEAWEFIRSDVIPRMLAERGPD
DPIRVWSAGCASGQEAYTLAMLLAEALGPDAFRQRVKIYATDVDEDALTE
ARAASYDARAVESVPPTLLSTYFEHVNGRYMFHKDLRRAVIFGRNDLVKD
APISRVDLLVCRNTLMYLNAETQRNVISRLHFALGAQGTLFLGHAEMLLS
HADRFTPLNLKHRIFRKAAGSHSGIERYDPTAAMYDRHGDLPGLTTVRDL
AFRASPVAQIVVTGEDTVAMINQQAESIFGLSARDIGRLLRDLEISYRPV
ELRAYIEQCKVERRSARIQDVKWQRPGSETVWFEIHVNPLVDNENGLLGV
SIVFFDVSATRALVDKVVQTNRQLEAAYEELQSTNEELETTNEELQSTVE
ELETTNEELQSTNEELETMNEELQSTNDELHTINDTLRDRSIELEDARTF
LDSMVNSIQLGMVVVDREMHVVVWNRHCEDLWGLRADETVGTPLTSLDIG
LPLDQVRPLIGNAFVDAGDPGEVVVDAVNRRGRAARIRVTCAPFRSPEGG
VKGALLLMEDQLAAHS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo