Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215188
StrainM_smegmatis_MKD8
Protein IDZP_20976472.1
Description putative C6 polyol ABC transporter- permease component [Mycobacteriu
Sequence MTTTEERASAEAAAEAEHVARIKKTQDPGVSRAEGWRRRGPLLPALIFMI
VVTQIPFLFTLYYSTLSWNLVRPGSREFVGLQNYVDVVQDATFWQAAFNS
VFFIVLTVLISVVLGLLLALLLDRVFLGRGVVRTLLITPFLVTPVAGALM
WKTAMLDPVFGFVNWLLPGGGIDFIGEFPRASIIVALVWQWTPFMMLLIL
AGLQSMPRDVLEAGRVDGANAFQLFRELTLPHLRRFIELGTVLGAIYLVN
TFDQIYMMTQGGPGTASANLPFYIYQRAFLGFDIGQAAAMGVIVVIFTMI
IATFALRLIFKSFSGAQEAA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo