Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215209
StrainM_smegmatis_MKD8
Protein IDZP_20976493.1
Description 5-10-methylenetetrahydromethanopterin reductase [Mycobacterium smegm
Sequence MPKEFRFGVSVRNAESQAQVAATARRAEDLGYNVIVVPDHLGAPAPFPTL
TAIAAATDTIRVGTFVLNACFYKPALLARDVTALRDLSDGRFEVGLGAGY
VREEFEAAELPFPSARERIDHLRHTTEYLREHASDVPIMVAGNGDRLLTV
AAQTADIVGLTGGDGVPDGDHDPLAERISFLRNAADGRDLELNITFTAIP
AAGSEMPDLRLTRRFLGHLTDEQLLRHPGVLAGSASDMADRLRQLRDTYG
VSYFIVQVPHIETFAKVIAELR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo