Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215256
StrainM_smegmatis_MKD8
Protein IDZP_20976540.1
Description beta-lactamase superfamily Zn-dependent hydrolase [Mycobacterium sme
Sequence MLRAALRLTTRSAGLLAGGWLLGALRGTYASVGAQPRDIKPVATRSPQFD
GKVFVNIEPASPGINLDREERRRLFAEMFGSKGASWPPGEIPLAEPTEAE
TAEAKPCAVSWYGHSSALIEVDGYRVLTDPIWSDRCSPSRVVGPRRLHAP
PVPLEALPAVDAVVISHDHYDHLDIDTVRGLARTQRAPFLVPLGIGAHLR
KWGIPEARIVELDWNESHRIGDLTIVCTPARHFSGRFLQRNTTLWASWVV
IGPGHRAFFGGDTGYTKSFSEIGSEHGPFDLTLLPVGAYNPGWPDIHMNP
EESVRAHLDMTESGLLVPIHWATFRLAPHPWAEPVRRLLAAADPAGVQVA
VPKPGQRVDGGSPVLDPWWQL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo