Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215340
StrainM_smegmatis_MKD8
Protein IDZP_20976568.1
Description ABC superfamily ATP binding cassette transporter- membrane protein [
Sequence MSVTDWRGRLQEEQDPNNNDNLPIDESIPLRREARSLLISLLRPYRWIVA
VLALVVIVENAARLSVPVLVQRGIDHGIPPILAGGPARELMVIVATLCVV
VLVQATSRMFFLRRSGRVGQKVLLELRRRVFRHFQRLDLAFHDRYTSGRV
VSRSTNDVEAIQDMLETGFDSLITAVLTLFGTAVLLVVLDWRLGLMCLAA
FPILVALVWWFRNESARTYRKVRESAALVIVQFVETMTGIKAVQAYRREP
RNQEIFSDIADDYREINEKTFKLLAIFMPGVKLVGNITTGVVLIYGGYRV
LNDQMTIGTLAAFLLYLRMFFEPMQEISQFFNTFQSASSALEKLAGVLAQ
QPGIADPERPVALHAVAGTITFDHVHFAYAPGRPVLPDLTLTVPAGQTVA
LVGTTGAGKTTIAKLIARFYDPTSGTVTLDGVDLCDLSQSELRRHVVMVT
QENFMFEGTVADNIRFGRPDATDAQVRAAAEAVGADRFIATLPEGYGTDV
AKRGGRLSAGQRQLIAFARAFLADPAVLILDEATSSLDIPSERMVQRALE
TVLADRTALVIAHRLSTVQIADRVLVLEHGRIIEDGSPADLIGRTDGAYA
ALHRAWVDSLA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo