Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215702
StrainM_smegmatis_MKD8
Protein IDZP_20976632.1
Description urease- alpha subunit [Mycobacterium smegmatis MKD8]
Sequence MAYRIDRRRYAELYGPTTGDRVRLADTELLAKVEADATVYGDEAVFGGGK
TMREGMAVHGDVTNGAGALDFVITNALIIDAALGIRKADIGIRNGRIAGI
GKAGNPRTMDGVDPELIIGAGTDIRSGEGMIATAGAIDVHVHFDSAGLVE
EAISSGITTMIGGGLGPVTVGITSSGPNNLARMLRAAEAFPMNFGFIGNG
SASSVAPLLEQGLAGAIGYKIHEDWGATPAAIRASLDAGDELDLQVQIHT
DTLNESGFFEDTMAAIAGRTIHTYHAEGAGGGHAPDIMRVVGESYCLPSS
TNPTNPYTLNTFDEHLDMVMVCHHLNPRIPEDVAFAESRIRRETIAAEDV
LHDLGAISAMGSDSQGMGRIGETIARTWQLASHMRATRGALPADEGTGAD
NARILRYVAKLTINPARLFGIDHEVGSLEPGKLADIVLWEPKFFGIRPEV
VFKGGFPAWSVMGEANASLMTCEPLRYRPQWAAYGRTPADVSVNFVAGAA
VENKLGEKLGLETPLVACRGSRRLSKADLLHNDHLPEITIEPDTYRVVVD
GQLCQSTPMTSVPLGRRYTLK
B cell epitope (IEDB)3
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo