Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215875
StrainM_smegmatis_MKD8
Protein IDZP_20976697.1
Description phosphate ABC transporter- phosphate-binding protein PstS [Mycobacte
Sequence MKLNSMGRKVGRPVGIAAAAIAALTLSACGSDNNAPATGTSGAATSGSAA
SAECGGKNSLTAEGSTAQQNAIAEFNKAWGQVCGGKNLSYNPTGSGAGRE
QFIAKQVDIAGSDSALSGDQVAAAAERCGGNPAWNLPLVFGPVAMAYNLE
GVDKLVLNGDLLAKIFQGQITKWNDPAIAGLNEGASLPDAAITPIYRSDS
SGTTDNFQKYLTAAAPQSWTKGDGSEFNGGAGEGAQKSSGVVQAVQATPG
SIGYVEKGFAEQAGLPFAQIDSGAGAVELTDESAAKAIDAAKFAAEGNDL
ALDLNSLYGTKEAGAYPLVLATYEIVCSKGYDADTAAAVKSFLTVAANEG
QANLSAAGYVPLPNAFKERLLTSIDAIS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo