Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215948
StrainM_smegmatis_MKD8
Protein IDZP_20976770.1
Description H-N-H endonuclease F-TflIV [Mycobacterium smegmatis MKD8]
Sequence MCQGSARRQASTKRWLESGQASIGTLPDHYIRQYLTTEQGGCCAICGGAT
TWQGLPLTLVLDHIDGDPTNNRRENLRLVCPNCDSQLPTYKSRNRGNGRH
FRRQRYADGKSY
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo