Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215980
StrainM_smegmatis_MKD8
Protein IDZP_20976802.1
Description long-chain-fatty-acid--CoA ligase FadD17 [Mycobacterium smegmatis MK
Sequence MTETIDPQTVTALLAPLADVTDRGVHEGDSFVSWSEHITAGAQVGAALRA
RLDPQRPGHVGVLLGNTTFFSSLLVAAGLTGLVPVGLNPTRRGEALRRDI
VRADCQVVLTDTPDLVPAGMNEVPVIDVESADWAAELDAHRGAPVRFAAT
RADDLFMLIFTSGTSGEPKAVRVTHDKVAFPGRMLAERFGLGPSDTAYLS
MPLFHSNAIMAGWSVAVAAGASIALRRRFSASSFIDDVRCYGATYANYVG
KPLSYILATEPRPDDADNPLKILYGNEGAPGDLQRFAERFGVHVVDGFGS
TEGGVAIARTPDTPDGALGPLTDQVAIVDVDTGEPCPPGRVGELVNPTGP
GWFRGYYNDPQAEAERMAGGVYHTGDLAYRDEEGYVYFAGRLGDWMRVDG
ENLGTAPIERILLRHPGIVEVAVYPIPDPAVGDQVMAAVVPAPGAVLDPG
QFRAFLAAQDDLGPKQWPSYVRVSTELPRTETFKVLKRQLSAEGIDCTDP
VWPIVRGARTNTTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo