Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216135
StrainM_smegmatis_MKD8
Protein IDZP_20976851.1
Description asparagine synthase [Mycobacterium smegmatis MKD8]
Sequence MCGICGIWNPFDAASGRTRIDRMLESIVHRGPDGAGRFEQPGINLGMRRL
AIIDLSGGDQPIFNEDRSVAVVFNGEIYNFRELRAQLEQSGHRFTTRSDT
EVLVHGYEQWGDDLLHRLAGMFTFALWDHNKRRLLIARDRFGKKPLYYSR
LGRELVFGSEIKALLAAGVSADLDDNALQHYLSLRYVPAPQTLFRSIMQL
PPGHKIVLGDNEFAVERWWRLSYEPKTTYSLTEAADAVEQLMRTAVQRRL
VSDVPLGCFLSGGLDSSTVLSFMSELTDEPVRTFSIGFDEGWASDELPAA
RSTAQAFGARHHEMRLSPGEFLRSLPAAVWHRDEPLAEPSEIPLMALSRM
AREHVTVVLSGEGGDELFGGYPKYRVDSLLARAGRMGRGVMGEHRLHSLA
AWHRLPRRARMAVTALATADPAERWPAWFGADRQVRLSANGLRPLDSVLD
SIDGNMGSLDRMLALDVETYLADNLLVRGDKMTMAASIESRMPLLDHDLA
EFVARLPEQLKASPRQAKIVVREIAKRRLPASLLSRKKIGFAVPISPWFR
DELGDALEHYTLGRDARPDPLVAPDRVRRALALHRAGRYDFGKELWSLLT
LDVWARIYLDGADPASISLARGD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo