Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216163
StrainM_smegmatis_MKD8
Protein IDZP_20976879.1
Description putative undecaprenyl-phosphate glycosyl-1-phosphate transfe [Mycoba
Sequence MTAQISNFDSQFGTSRPLSVARTAPFVAGTNISIKLPPSSVFQRSNWQKS
YSTHLLLTDTAVIAVSIAFAQIVRFGPTLHPHGYPKFYVPAFSILFAIAW
LSALSALRTRSPRITAASVDEYRRVTAASFWTFGAIAMVSLLLKLDIARG
YLAVALPVGTLGLLVGRRAWHRHMARQRVAGRYRTAVLVFGEVDAATELA
SELMRNSADGYQVVGLGVPRYGVPRGEYMTVNGQRVPIIGGEAEMLDAVH
SCGADTVAIAGTEAFGLRGIRRLLWQLEPMGVDLVVSTGAMDVALSRLVM
QPIAGIPLLHIEKPLYRNAKRIQKYLFDMCFALAVLVLTVPLLVITAVAI
KVTSSGPVFYASERIGVDGKLFSMLKFRTMVENADQLLDDLRELNESDGL
LFKIHDDPRVTRIGKILRRFSIDEIPQFINVVRGEMSVVGPRPPLRSEVE
EYDCEILRRLLVKPGVTGLWQVSGRSDLTWEQAVRLDLSYVDNWSMMSDV
LIVAKTFGAVLRKDGAY
gene ID441216163
StrainM_smegmatis_MKD8
Protein IDZP_20976879.1
Description putative undecaprenyl-phosphate glycosyl-1-phosphate transfe [Mycoba
Sequence MTAQISNFDSQFGTSRPLSVARTAPFVAGTNISIKLPPSSVFQRSNWQKS
YSTHLLLTDTAVIAVSIAFAQIVRFGPTLHPHGYPKFYVPAFSILFAIAW
LSALSALRTRSPRITAASVDEYRRVTAASFWTFGAIAMVSLLLKLDIARG
YLAVALPVGTLGLLVGRRAWHRHMARQRVAGRYRTAVLVFGEVDAATELA
SELMRNSADGYQVVGLGVPRYGVPRGEYMTVNGQRVPIIGGEAEMLDAVH
SCGADTVAIAGTEAFGLRGIRRLLWQLEPMGVDLVVSTGAMDVALSRLVM
QPIAGIPLLHIEKPLYRNAKRIQKYLFDMCFALAVLVLTVPLLVITAVAI
KVTSSGPVFYASERIGVDGKLFSMLKFRTMVENADQLLDDLRELNESDGL
LFKIHDDPRVTRIGKILRRFSIDEIPQFINVVRGEMSVVGPRPPLRSEVE
EYDCEILRRLLVKPGVTGLWQVSGRSDLTWEQAVRLDLSYVDNWSMMSDV
LIVAKTFGAVLRKDGAY
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo