Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216319
StrainM_smegmatis_MKD8
Protein IDZP_20976943.1
Description cation ABC transporter- periplasmic cation-binding protein- putative
Sequence MRTLAVSVALAAPFALAACGSDESSTAEPAGDCPTTPVNVVVSVDQWGDI
VSELGGACAKVTTVLAGSSVDPHDFEPSPSDAAKFEGAQLVVINGGHYDE
WAGKLARSSAPNAPVVAAVADAGAHEDDAHDHGHDEHGHAHAEEGVNPHA
WYSPAAVTTVADEVTAKLGDLAPEAKDYFAERRAAFTESMKPYNQLIDDI
KAKASGKTYAATEAVFDDMAAAVGLTDRTPPGYQVASSNETDPSPADFDA
FLTLLENRGVDVLIYNVQTEGSVPQQLRTAAESAGIPVVEVTETVAPDAD
SFEAWQVDQLTALAKALGVES
gene ID441216319
StrainM_smegmatis_MKD8
Protein IDZP_20976943.1
Description cation ABC transporter- periplasmic cation-binding protein- putative
Sequence MRTLAVSVALAAPFALAACGSDESSTAEPAGDCPTTPVNVVVSVDQWGDI
VSELGGACAKVTTVLAGSSVDPHDFEPSPSDAAKFEGAQLVVINGGHYDE
WAGKLARSSAPNAPVVAAVADAGAHEDDAHDHGHDEHGHAHAEEGVNPHA
WYSPAAVTTVADEVTAKLGDLAPEAKDYFAERRAAFTESMKPYNQLIDDI
KAKASGKTYAATEAVFDDMAAAVGLTDRTPPGYQVASSNETDPSPADFDA
FLTLLENRGVDVLIYNVQTEGSVPQQLRTAAESAGIPVVEVTETVAPDAD
SFEAWQVDQLTALAKALGVES
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo