Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216331
StrainM_smegmatis_MKD8
Protein IDZP_20976955.1
Description mspD protein [Mycobacterium smegmatis MKD8]
Sequence MGVGINFSYTTPNILIDGGDITQPPFGLDTIITPNLFPGVSISADLGNGP
GIQEVATFSVDVKGAKGAVAVSNAHGTVTGAAGGVLLRPFARLIASTGDS
VTTYGEPWNMN
gene ID441216331
StrainM_smegmatis_MKD8
Protein IDZP_20976955.1
Description mspD protein [Mycobacterium smegmatis MKD8]
Sequence MGVGINFSYTTPNILIDGGDITQPPFGLDTIITPNLFPGVSISADLGNGP
GIQEVATFSVDVKGAKGAVAVSNAHGTVTGAAGGVLLRPFARLIASTGDS
VTTYGEPWNMN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo