Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216341
StrainM_smegmatis_MKD8
Protein IDZP_20976965.1
Description ribosomal protein L33 [Mycobacterium smegmatis MKD8]
Sequence MARNEIRPIVKLRSTAGTGYTYVTRKNRRNDPDRIVLRKYDPVLRRHVEF
REER
gene ID441216341
StrainM_smegmatis_MKD8
Protein IDZP_20976965.1
Description ribosomal protein L33 [Mycobacterium smegmatis MKD8]
Sequence MARNEIRPIVKLRSTAGTGYTYVTRKNRRNDPDRIVLRKYDPVLRRHVEF
REER
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo