Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216484
StrainM_smegmatis_MKD8
Protein IDZP_20977004.1
Description ATP-dependent zinc metalloprotease FtsH [Mycobacterium smegmatis MKD
Sequence MNRKNVIRTLTVIGVVLLLGWSFFYFSDDTRGYKPVDTTVALAQIRGDNV
NSAQIDDREQQVRLDLKSGNGDTENSDKIITKYPTGYGVTLFNALQDKGA
KTNTVVNQGSVFGTLLIYMLPLLLLVALFVMFSRMQTGGRMGFGFGKSRA
KQLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQ
AKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRQ
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLKVHSQGKP
IAPDADLDGLAKRTVGMSGADLANVINEAALLTARENGTVITGPALEEAV
DRVVGGPRRKSRIISEHEKKITAYHEGGHTLAAWAMPDIEPIYKVTILAR
GRTGGHAVAVPEDDKGLMTRSEMIARLVFAMGGRAAEELVFREPTTGAVS
DIEQATKIARAMVTEYGMSSKLGAVRYGTEHGDPFLGRTMGTQADYSHEV
AQIIDDEVRKLIEAAHTEAWEILTEYRDVLDILAGELLEKETLHRAELEA
IFGDVKKRPRLTMFDDFGGRVPSDKPPIKTPGELAMERGEPWPPPVPEPA
FKAAIAAANREAEKRNGTNGAPSNGAPAPAGPTQPDYGAPAGWHAPGWPP
PQQSQQPGYQPQQGYWYPPPHPSGWQQPQPYPYQPYPHPGQQGTSPEHGR
PSEQSGQDDGHTGDRSNPHG
B cell epitope (IEDB)0
T cell epitope (IEDB)3
MHC binder (IEDB)1
Vaccine TargetNo