Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216511
StrainM_smegmatis_MKD8
Protein IDZP_20977031.1
Description putative magnesium/manganese-dependent protein phosphatase [Mycobact
Sequence MRAPFDRVIASPVDLPGPGQRRLSLLLVEDDRADAILVEELIADAPDIDF
VWAKSISDAERTLADHRPDCVLLDLNLPDAAGIDALHHLSKLDARIPIIV
LTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRRAVLYAIERKRAELTSV
DLHASQLRAQENARLERGLLPSPLLMEGSGVDIVVEARPSRQHALIGGDF
YDVVQTPDRTVHVMIGDVAGHGPDEAALGVALRIGWRALTFAGLRGNERM
RQLDRILTTERAGKGIFATLCSVALEPDSGRFTVVRAGHPGLLVHGNGTV
DWLEPRPGAALGLGAREWPVNHYELPEGHGLLLLTDGLFEGHAGRGDERL
GESGLLAVARAFAATPGRDFVTSLINEAESRAQTHGGLSDDIAVIRVERS
HR
gene ID441216511
StrainM_smegmatis_MKD8
Protein IDZP_20977031.1
Description putative magnesium/manganese-dependent protein phosphatase [Mycobact
Sequence MRAPFDRVIASPVDLPGPGQRRLSLLLVEDDRADAILVEELIADAPDIDF
VWAKSISDAERTLADHRPDCVLLDLNLPDAAGIDALHHLSKLDARIPIIV
LTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRRAVLYAIERKRAELTSV
DLHASQLRAQENARLERGLLPSPLLMEGSGVDIVVEARPSRQHALIGGDF
YDVVQTPDRTVHVMIGDVAGHGPDEAALGVALRIGWRALTFAGLRGNERM
RQLDRILTTERAGKGIFATLCSVALEPDSGRFTVVRAGHPGLLVHGNGTV
DWLEPRPGAALGLGAREWPVNHYELPEGHGLLLLTDGLFEGHAGRGDERL
GESGLLAVARAFAATPGRDFVTSLINEAESRAQTHGGLSDDIAVIRVERS
HR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo