Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216516
StrainM_smegmatis_MKD8
Protein IDZP_20977036.1
Description tellurium resistance TerC family protein [Mycobacterium smegmatis MK
Sequence MHVTQLEWIITLSVTIAVLLFDVVIIGRRPHEPTRRETATYLSIYIGLAI
AFGVWTWLFHGHRYGVEFFAGWLTEYSLSVDNLFIFLIIMASFKVPRIYQ
QQALLVGIILALIFRGIFIALGAVAINQFSWVFYIFGAFLVYTAVNLVRD
TDHDDDGDNAVVRFARKHLRTTDKWDGLRLWVRENGKRLITPMFLVIVAL
GTTDLLFALDSIPAIYGLTQEPYLVFTANVFALMGLRQLYFLLGDLLKRL
VYLSQGLAFILAFIGVKLILHALHENELPFINGGEPVHVPEIPTLASLGV
IVVTLLITTAASLYKTRVRDAQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo