Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216523
StrainM_smegmatis_MKD8
Protein IDZP_20977043.1
Description UDP-glucose 4-epimerase [Mycobacterium smegmatis MKD8]
Sequence MRTLVTGAAGFIGSTLVDRLLADGHSVVGLDDLSSGRAENLHAAENSDKF
EFVKADIVDADLTGLLAEFKPEVIFHLAAQISVKRSVDDPPFDATVNVVG
TVRLAEAARLAGVRKVVHTSSGGSVYGTPPAYPTSEDMPVNPASPYAAGK
VAGEVYLNMYRNLYDLDCSHIAPANVYGPRQDPHGEAGVVAIFSQALLAG
RTTKIFGDGSDTRDYVYVDDVVDAFVRAGGPAGGGQRFNVGTGVETSTRE
LHTAIAKAVGAPDEPEFHPPRLGDLRRSRLDNTRAREVLGWQPQVPLADG
IAKTVEFFRNKSQ
gene ID441216523
StrainM_smegmatis_MKD8
Protein IDZP_20977043.1
Description UDP-glucose 4-epimerase [Mycobacterium smegmatis MKD8]
Sequence MRTLVTGAAGFIGSTLVDRLLADGHSVVGLDDLSSGRAENLHAAENSDKF
EFVKADIVDADLTGLLAEFKPEVIFHLAAQISVKRSVDDPPFDATVNVVG
TVRLAEAARLAGVRKVVHTSSGGSVYGTPPAYPTSEDMPVNPASPYAAGK
VAGEVYLNMYRNLYDLDCSHIAPANVYGPRQDPHGEAGVVAIFSQALLAG
RTTKIFGDGSDTRDYVYVDDVVDAFVRAGGPAGGGQRFNVGTGVETSTRE
LHTAIAKAVGAPDEPEFHPPRLGDLRRSRLDNTRAREVLGWQPQVPLADG
IAKTVEFFRNKSQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo