Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216558
StrainM_smegmatis_MKD8
Protein IDZP_20977078.1
Description alpha/beta hydrolase fold family hydrolase [Mycobacterium smegmatis
Sequence MPAPDPSVTRIDGPWRHLQVHANGIRFHVVEAAPEAVEPGVTSDRPLVIL
LHGFGSFWWSWRHQLTGLRDARVVAVDLRGYGGSDKPPRGYDGWTLAGDT
AGLVRALGHTSATLVGHADGGLVCWATSVLHPRAVNAIAVISSPHPVALR
ASALRRRDQGRALLPWMLGYQVPMWPERKLTRHDAAELERVVRSRAGDAW
QQTPDFAETMRHLRRAIQIPGAAHSALEYQRWAVRSQLRGEGRRFMASMR
RPVNVPVLHLRGDEDPYVLPDPVYRTQRFAPHGRYVSITGAGHFAHEEQP
DAVNEQLGRFLTQIRS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo