Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216792
StrainM_smegmatis_MKD8
Protein IDZP_20977155.1
Description putative SAM-dependent methyltransferase [Mycobacterium smegmatis MK
Sequence MTSHVLDWDGAYRGDTGFQGPPPWNIGEPQPELAALHRAGRFRSDVLDAG
CGHAELSLALAADGYTVVGMDLSPSAIAAANRAAQERNLATASFVQGDIT
SFTGYDGRFSTVIDSTLFHSLPVEGREGYLQSIHRASAPGARYFVLVFAK
GAFPADLEVKPNEVIEEELRTTVGKYWVVDDIRPAFIHANAVVFPDAPEL
PPHGYDDKGRIMFPAFLLEAHRD
gene ID441216792
StrainM_smegmatis_MKD8
Protein IDZP_20977155.1
Description putative SAM-dependent methyltransferase [Mycobacterium smegmatis MK
Sequence MTSHVLDWDGAYRGDTGFQGPPPWNIGEPQPELAALHRAGRFRSDVLDAG
CGHAELSLALAADGYTVVGMDLSPSAIAAANRAAQERNLATASFVQGDIT
SFTGYDGRFSTVIDSTLFHSLPVEGREGYLQSIHRASAPGARYFVLVFAK
GAFPADLEVKPNEVIEEELRTTVGKYWVVDDIRPAFIHANAVVFPDAPEL
PPHGYDDKGRIMFPAFLLEAHRD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo