Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216884
StrainM_smegmatis_MKD8
Protein IDZP_20977164.1
Description NDMA-dependent methanol dehydrogenase [Mycobacterium smegmatis MKD8]
Sequence MAIELNQIWDFPIKEFHPFPRALLGVGAHDIIGVEAKNLGFKRTLLMTTG
LRGSGIIEELTGKIEYQGVEVVLYDKVESNPKDYNVMEAAALYQQEKCDS
IISVGGGSSHDAAKGARVVIAHDGRNINEFEGFAKSTNKQNPPHIAVSTT
AGTGSETSWAYVITDTSDMDHPHKWVGFDEATIVTLAIDDPLLYYSCPQH
FTAYCGFDVLAHGSEPFVSRLDFAPSLGNALYSVELVAKHLREAVFEPRN
LKAREGMMNAQYIAGQAFNSGGLGIVHSISHAVSAFFDSHHGLNNAIALP
RVWEYNLPARYERYAQLATAMGVDTRNMTTVQAADAAVEAAIRLAQDVGI
PDNFSQVRVDSYAKNQMNTGKYAGKGEVIKGDDKTVRAISEHIQDDWCTP
GNPREVTVESMIPVVNHAINESY
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo