Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216901
StrainM_smegmatis_MKD8
Protein IDZP_20977181.1
Description ammonium transporter [Mycobacterium smegmatis MKD8]
Sequence MDTGTTAFMLCCIIGLTLMIPGLALFYGGMVSVKSSTNMMMMTFGAVAVV
GLLWVLFGFSMVFGTSYGGFVGSFTEFAGLTDLLEPMTTVDGLPVSLFAV
FQALFAAITVALISGAVADRMKFGAWMVFAAFWAVLVYFPVAHWVFAFDG
TVTEDSVGGWIANRLGAVDFAGGTAVHINAGAAALALAIVLGKSAMFGRR
KPHNVPLTLLGAGMLWAGWYAFNGGSALSAGNSAAIVMVTTFVATCAAVL
AWIAVEKVKTGHVTGVGAASGAITGLVAITPACGAVTPIGAMFVGGIAGA
VCVYAVGLKDTFGYDDSLDVVGVHLVGGLIGTLLIGFFASEGMPNGVNGL
FYGGGIDQLWKQAVAAGAVMIYSFVLAYVIAFAIKKTMGIRISPDEEEKG
IDAKFHRDAAYELEFA
gene ID441216901
StrainM_smegmatis_MKD8
Protein IDZP_20977181.1
Description ammonium transporter [Mycobacterium smegmatis MKD8]
Sequence MDTGTTAFMLCCIIGLTLMIPGLALFYGGMVSVKSSTNMMMMTFGAVAVV
GLLWVLFGFSMVFGTSYGGFVGSFTEFAGLTDLLEPMTTVDGLPVSLFAV
FQALFAAITVALISGAVADRMKFGAWMVFAAFWAVLVYFPVAHWVFAFDG
TVTEDSVGGWIANRLGAVDFAGGTAVHINAGAAALALAIVLGKSAMFGRR
KPHNVPLTLLGAGMLWAGWYAFNGGSALSAGNSAAIVMVTTFVATCAAVL
AWIAVEKVKTGHVTGVGAASGAITGLVAITPACGAVTPIGAMFVGGIAGA
VCVYAVGLKDTFGYDDSLDVVGVHLVGGLIGTLLIGFFASEGMPNGVNGL
FYGGGIDQLWKQAVAAGAVMIYSFVLAYVIAFAIKKTMGIRISPDEEEKG
IDAKFHRDAAYELEFA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo