Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217040
StrainM_smegmatis_MKD8
Protein IDZP_20977223.1
Description ATP-dependent DNA ligase [Mycobacterium smegmatis MKD8]
Sequence MDLPVLPPVSPMLSKSVSTIPPGMSYEPKWDGFRSILFRDGAEVELGSRK
ERPMTRYFPELVAAALTELPDRCVVDGEIVLPADNRLDFEALQLRLHPAA
SRVAMLAEQTPAAFIAFDLLALGDDDYTGRPFSERRAALETALADAGPTF
HLTPATTDLPTAQRWFHEFEGAGLDGVIAKPLDLTYQPDKRVMFKIKHQR
TADCVVAGYRLHKSGADAVGSLLLGLYDDDGSLASVGVIGAFPMATRRAL
FTELQTLVTDFDHHPWNWAAQAAADPELARRYGGGSRWNAGKDLSFVPLR
TERVVEVRYDHMEGRRFRHTAQFNRWRPDRDARSCTFAQLDSPTALELGD
IVPGLAEPQ
gene ID441217040
StrainM_smegmatis_MKD8
Protein IDZP_20977223.1
Description ATP-dependent DNA ligase [Mycobacterium smegmatis MKD8]
Sequence MDLPVLPPVSPMLSKSVSTIPPGMSYEPKWDGFRSILFRDGAEVELGSRK
ERPMTRYFPELVAAALTELPDRCVVDGEIVLPADNRLDFEALQLRLHPAA
SRVAMLAEQTPAAFIAFDLLALGDDDYTGRPFSERRAALETALADAGPTF
HLTPATTDLPTAQRWFHEFEGAGLDGVIAKPLDLTYQPDKRVMFKIKHQR
TADCVVAGYRLHKSGADAVGSLLLGLYDDDGSLASVGVIGAFPMATRRAL
FTELQTLVTDFDHHPWNWAAQAAADPELARRYGGGSRWNAGKDLSFVPLR
TERVVEVRYDHMEGRRFRHTAQFNRWRPDRDARSCTFAQLDSPTALELGD
IVPGLAEPQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo