Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217067
StrainM_smegmatis_MKD8
Protein IDZP_20977250.1
Description glycine betaine/L-proline ABC superfamily ATP binding cassette trans
Sequence MQYLLTHLDDLWELTVIHLRLSLVPIVLGLLIAVPLGALVQRTTTLRRLT
TVAASIIFTIPSLALFVALPLVIPTRILDEANVIVALTLYTTALLVRAVP
EALDAVPEHVRDAATAVGYRPLIRMLKVELPLSIPVLVASLRVVAVTNIS
MVSVGSVIGIGGLGTWFTEGYQSNKSSQIIAGIIAIFVLAIIVDTLIMLA
GKLIAPWNRAEATA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo