Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217072
StrainM_smegmatis_MKD8
Protein IDZP_20977255.1
Description phosphoglycerate mutase family protein [Mycobacterium smegmatis MKD8
Sequence MQLLLIRHALPLRSEPGQGSDPVLSDVGLQQAARLPDALKRFPVTRVVSS
PQRRAVQTGEPLAGALGLPVEIDERLAEYDRDMSHYVPIEQIAQENPAEL
ARLAGGHLPSGVDEEEFAGRIGAAFDDLVAAGNHEDTVAVFSHGGVINVA
LHRILKTERLLSFHIDYASVTRVLASRSGRLSVASVNSTEHVWDLLPRNA
RW
gene ID441217072
StrainM_smegmatis_MKD8
Protein IDZP_20977255.1
Description phosphoglycerate mutase family protein [Mycobacterium smegmatis MKD8
Sequence MQLLLIRHALPLRSEPGQGSDPVLSDVGLQQAARLPDALKRFPVTRVVSS
PQRRAVQTGEPLAGALGLPVEIDERLAEYDRDMSHYVPIEQIAQENPAEL
ARLAGGHLPSGVDEEEFAGRIGAAFDDLVAAGNHEDTVAVFSHGGVINVA
LHRILKTERLLSFHIDYASVTRVLASRSGRLSVASVNSTEHVWDLLPRNA
RW
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo