Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217081
StrainM_smegmatis_MKD8
Protein IDZP_20977264.1
Description hypothetical protein D806_6432 [Mycobacterium smegmatis MKD8]
Sequence MQSEIPDAFAVGLFLPARQAIPFDEVLADHANSEPLQPYLAPCRDDADGH
ADAHIHVDEDRHLLDDEARRLDDERLARDIARFHAARREASMLAMINIAL
PLGESIVLSDGQDYLLHVARDERERLGTPDMRDLSRAASAMRQLVCAKLD
ALIADSVTVAADGDTLVYPDGAEAAVLGRLCPVCWYATRAALAQRAIDTA
ESPVLGQDLIDPTSVAVLYTLGLIEF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo