Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217091
StrainM_smegmatis_MKD8
Protein IDZP_20977274.1
Description lipopolysaccharide ABC superfamily ATP binding cassette transporter-
Sequence MTSSSAPRIETRDAWVEFPIFDAKTRSLKKAFLGKAGGAIGRNQSNVVVI
EALRDITMSLEMGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGSATVSGRV
APVFDLGVGMDPEISGFENIIIRGLFLGQTRKQMLAKVDEIAEFTELGEY
LSMPLRTYSTGMRVRLAMGVVTSIDPEILLLDEGIGAVDAEFLKKAQSRL
QDLVERSGILVFASHSNEFLARLCKTAMWIDHGTIKMTGGIEEVVRAYEG
EDAARHVREVLEETARDTH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo