Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217104
StrainM_smegmatis_MKD8
Protein IDZP_20977287.1
Description transcriptional regulator LacI family protein [Mycobacterium smegmat
Sequence MSAEVPSRRQRSTRVSAADVARAVGVSPATVSYVMNGRAGVSEQTRARIL
EVAEALGHISSARADRLRSHQTRVIGLILTDIANPFYTEIAAGTIDAARA
RGYEVFLAHTQEDPQTLRSIVDTMIARQVDGVVITVLHPDDGEVIRSLRS
ARIPLVQLSRRIQRVDADFVGIDDRAAASEMMEHVVTHGYQDIVTVVGPR
TSSASAAREEGFIRTAEAHGIRTVSSQRISTYLSERGGYEAVEQVLARKS
LPRVIVCGSDVIALGAISALRERSLNVPDDVAVTGFDGLYPGPLVELTTI
NQPRREMAEQSIELLTRRIEGAGGSYQSVLRAHQLRIGTTCGCPRMRPHL
AA
gene ID441217104
StrainM_smegmatis_MKD8
Protein IDZP_20977287.1
Description transcriptional regulator LacI family protein [Mycobacterium smegmat
Sequence MSAEVPSRRQRSTRVSAADVARAVGVSPATVSYVMNGRAGVSEQTRARIL
EVAEALGHISSARADRLRSHQTRVIGLILTDIANPFYTEIAAGTIDAARA
RGYEVFLAHTQEDPQTLRSIVDTMIARQVDGVVITVLHPDDGEVIRSLRS
ARIPLVQLSRRIQRVDADFVGIDDRAAASEMMEHVVTHGYQDIVTVVGPR
TSSASAAREEGFIRTAEAHGIRTVSSQRISTYLSERGGYEAVEQVLARKS
LPRVIVCGSDVIALGAISALRERSLNVPDDVAVTGFDGLYPGPLVELTTI
NQPRREMAEQSIELLTRRIEGAGGSYQSVLRAHQLRIGTTCGCPRMRPHL
AA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo