Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217351
StrainM_smegmatis_MKD8
Protein IDZP_20977335.1
Description hypothetical protein D806_6506 [Mycobacterium smegmatis MKD8]
Sequence MASQPMGSGSALPQPEWHTSGHLQTRHQMVAFLRACVIAAILLGVLAFIV
WF
gene ID441217351
StrainM_smegmatis_MKD8
Protein IDZP_20977335.1
Description hypothetical protein D806_6506 [Mycobacterium smegmatis MKD8]
Sequence MASQPMGSGSALPQPEWHTSGHLQTRHQMVAFLRACVIAAILLGVLAFIV
WF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo