Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217695
StrainM_smegmatis_MKD8
Protein IDZP_20977369.1
Description oxidoreductase molybdopterin binding domain- putative [Mycobacterium
Sequence MVRLLVFTGVSMLALLAGTGAAAAEPQVSTDLSVTGDVGAPLTMTREALR
ALPNRTLDATFTTHDGPQHHTYTGALLSDAITAAHPAGGPNAEHPLLTVA
VVATGADGYAATLAWGDIDPSVTPTPALVAWAQDGTDLDAPRLVLPGDLN
GSRYVSELRELRVAQLA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo