Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217761
StrainM_smegmatis_MKD8
Protein IDZP_20977435.1
Description spermidine/putrescine ABC superfamily ATP binding cassette transport
Sequence MSTSTTTGTSTGSNRALRRAVRATLWVLFGLFFLFPLYAMADFSTRNLIS
GGRTLAAWGNLVADEALYRAIVISLLLAVFTVVAMLVLLVPTMIWVRLRA
RWARRIVEFLCLLPLTIPALVIVVGLRNVYLWVTYFLGESALTLTFVYVV
LVLPFAYRAIDSALAAIDLQTLSEAARSLGAGWFTTITRVIVPNIWSGIL
SAAFISIAVVLGEYTIASLSGFETLQVQIVLIGKSDGPTSVAASLAVLLL
GFVLLLALAVLTRGRRRTLGDQG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo