Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218004
StrainM_smegmatis_MKD8
Protein IDZP_20977471.1
Description putative siderophore-interacting FAD-binding domain protein- partial
Sequence MARGIQGVMMRGFGARDHQATVVSTEAITPNLLRLRMVSPTLFEDAVAEP
TSWLRFWFPDPAGSKTEFQRAYTMSEMSPETGEFAIDVVLHEPAGPASRW
ARSAKPGDAIAVMTLGSAGFSVPEDPPAGYLLIGDAAATPAINGIIGVVP
HDIPIEVYLEEHDENDRLIPIAEHPRMRVHWVVREDATSLAGAIEARDWS
NWYCWVTPEAGSLKHLRTRLRDEFGFPKAELHPQAYWTEGRAMGTKRGDD
DKTPEVNPAPRADKPAPAAPAAAGR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo