Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218018
StrainM_smegmatis_MKD8
Protein IDZP_20977485.1
Description putative lipoprotein [Mycobacterium smegmatis MKD8]
Sequence MRNSAVVFAVAALALAGCTPQHEEHTMAQTVTFADPWASAADTGMTAVFG
TLQNTGHHDAHIVSATSPVAEMVELHEVAADANGVKTMRPKEAGFAVPAG
GEHELAPGGDHIMLMDLTAPLQPGADVEVTVMFDDGSSLPVQAQVRDFPG
GKENYQPAKPHDHG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo