Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218044
StrainM_smegmatis_MKD8
Protein IDZP_20977511.1
Description amino acid ABC transporter membrane protein- PAAT family [Mycobacter
Sequence MAVAEPLPIVRLRHWGRWVGAAVIVAALVLLFIALSRAQIKWSSVPDFVV
YRVMVVGLVNTVLLALVAQAAAIVIGVGIALLRRSANPVARWFAAAYIWL
FRGLPVLLQILIWYNLALVIPVISIPLPMGGYLLQEPTNALVSAFTAALL
GLALNESAYMAEIVRAGLNSVDSGQVEAAKSIGMTPAQTLRRIVLPQAMR
VIIPPTGNDFIDMLKGTSIASVIGVTELLHAANNISSNNLLVMETLFAAA
IWYMVVVTLAGFGQHYLERWFGGAERSAAAQATRALRAVPLKRSARV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo