Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218384
StrainM_smegmatis_MKD8
Protein IDZP_20977591.1
Description putative ferredoxin [Mycobacterium smegmatis MKD8]
Sequence MRVSVDLNRCQDHGQCVIAAPSVFSMTDDGVLEYISTPSESERFAVEEAA
DVCPLQAITIED
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo