Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218420
StrainM_smegmatis_MKD8
Protein IDZP_20977627.1
Description hypothetical protein D806_6793 [Mycobacterium smegmatis MKD8]
Sequence MEDNWEVVIADPDSQGEPRDEEVLMRGAEDEARRVYIDRTAEAADRGHAY
VKLRRDGTDVETWPQLTGWTV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo