Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218430
StrainM_smegmatis_MKD8
Protein IDZP_20977637.1
Description activator of Hsp90 ATPase 1 family protein [Mycobacterium smegmatis
Sequence MPVTDVKHDLDTLTLTITAEFAAPVTRIWQIYADPRQLEKVWGPPSHPAT
VVDHDLRPGGRVTYFMTGPDGEKYAGYWEITAVDEPHSFSFLDGFADEDF
NPNTDLPVSTNVYTFTEHDGGTRATYVGTYASAEALQQVLDMGVIEGASS
AINQIDALLTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo